SH3BGRL Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33609
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: FNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SH3BGRL Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: SH3BGRL

Product images

Western Blot: SH3BGRL Antibody [NBP2-33609] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: SH3BGRL Antibody [NBP2-33609] - liver cancer

Immunohistochemistry-Paraffin: SH3BGRL Antibody [NBP2-33609] - Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in white pulp.

Immunohistochemistry-Paraffin: SH3BGRL Antibody [NBP2-33609] - liver