MRPS16 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33587
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: ALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDT
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: MRPS16 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: MRPS16

Product images

Western Blot: MRPS16 Antibody [NBP2-33587] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: MRPS16 Antibody [NBP2-33587] - liver cancer

Immunohistochemistry-Paraffin: MRPS16 Antibody [NBP2-33587] - Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MRPS16 Antibody [NBP2-33587] - liver