CCT6A Antibody
| Name | CCT6A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33583 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCT6A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCT6B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CCT6B Antibody [NBP2-33583] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15140_CCT6B-Antibody-Western-Blot-NBP2-33583-img0004.jpg)
Western Blot: CCT6B Antibody [NBP2-33583] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: CCT6B Antibody [NBP2-33583] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15141_CCT6B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33583-img0005.jpg)
Immunocytochemistry/Immunofluorescence: CCT6B Antibody [NBP2-33583] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
![Immunohistochemistry: CCT6B Antibody [NBP2-33583] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15142_CCT6B-Antibody-Immunohistochemistry-NBP2-33583-img0001.jpg)
Immunohistochemistry: CCT6B Antibody [NBP2-33583] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.