CAMLG Antibody
| Name | CAMLG Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33661 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CAMLG Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CAMLG |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: CAMLG Antibody [NBP2-33661] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7128_CAMLG-Antibody-Western-Blot-NBP2-33661-img0005.jpg)
![Immunohistochemistry-Paraffin: CAMLG Antibody [NBP2-33661] - Staining of human cerebellum shows cytoplasmic and nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7129_CAMLG-Antibody-Immunohistochemistry-Paraffin-NBP2-33661-img0001.jpg)