UTP14C Antibody

Name UTP14C Antibody
Supplier Novus Biologicals
Catalog NBP2-33483
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: ARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLAKNKELTQKLQVASESEEE
Purity/Format Immunogen affinity purified
Blocking Peptide UTP14C Protein
Description Rabbit Polyclonal
Gene UTP14C
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.