BOP1 Antibody
| Name | BOP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33504 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BOP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BOP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: BOP1 Antibody [NBP2-33504] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25441_BOP1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33504-img0005.jpg)
Immunocytochemistry/Immunofluorescence: BOP1 Antibody [NBP2-33504] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & nucleoli.
![Immunohistochemistry: BOP1 Antibody [NBP2-33504] - Immunohistochemical staining of human testis shows nuclear positivity in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25442_BOP1-Antibody-Immunohistochemistry-NBP2-33504-img0006.jpg)
Immunohistochemistry: BOP1 Antibody [NBP2-33504] - Immunohistochemical staining of human testis shows nuclear positivity in seminiferus ducts.