TULP2 Antibody
| Name | TULP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33459 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LGDRGLGNPFLRKKVSEAHLPSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRNLGLQSPFLSWLPDNSDAELEEVSVENGSVSPPPFKQSPRIRR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TULP2 Protein |
| Description | Rabbit Polyclonal |
| Gene | TULP2 |
| Supplier Page | Shop |
Product images
![Western Blot: TULP2 Antibody [NBP2-33459] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17262_TULP2-Antibody-Western-Blot-NBP2-33459-img0003.jpg)
Western Blot: TULP2 Antibody [NBP2-33459] - liver cancer
![Immunohistochemistry: TULP2 Antibody [NBP2-33459] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17263_TULP2-Antibody-Immunohistochemistry-NBP2-33459-img0002.jpg)
Immunohistochemistry: TULP2 Antibody [NBP2-33459] - liver
![Immunohistochemistry: TULP2 Antibody [NBP2-33459] - Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17265_TULP2-Antibody-Immunohistochemistry-NBP2-33459-img0001.jpg)
Immunohistochemistry: TULP2 Antibody [NBP2-33459] - Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
![Western Blot: TULP2 Antibody [NBP2-33459] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/29975_TULP2-Antibody-Western-Blot-NBP2-33459-img0005.jpg)
Western Blot: TULP2 Antibody [NBP2-33459] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4