ANKRD34C Antibody
| Name | ANKRD34C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33442 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LIAPSVLAASTRQDETHGASTDNEVIKSISDISFPKRGPLSRTNSIDSKDPTLFHTVTEQVLKIPVSSAPASWKAAYEKGQAPHPRLARRGTL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ANKRD34C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ANKRD34C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ANKRD34C Antibody [NBP2-33442] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26665_ANKRD34C%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33442-img0006.jpg)
Immunocytochemistry/Immunofluorescence: ANKRD34C Antibody [NBP2-33442] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
![Immunohistochemistry: ANKRD34C Antibody [NBP2-33442] - Staining of human urinary bladder shows strong granular cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26666_ANKRD34C-Antibody-Immunohistochemistry-NBP2-33442-img0001.jpg)
Immunohistochemistry: ANKRD34C Antibody [NBP2-33442] - Staining of human urinary bladder shows strong granular cytoplasmic positivity in urothelial cells.