RPIP8 Antibody
| Name | RPIP8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80855 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RPIP8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RUNDC3A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RPIP8 Antibody [NBP1-80855] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-489](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/2400_RPIP8-Antibody-Western-Blot-NBP1-80855-img0005.jpg)
Western Blot: RPIP8 Antibody [NBP1-80855] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-489
![Immunocytochemistry/Immunofluorescence: RPIP8 Antibody [NBP1-80855] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/2401_RPIP8%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80855-img0008.jpg)
Immunocytochemistry/Immunofluorescence: RPIP8 Antibody [NBP1-80855] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
![Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP1-80855] - Staining of human hippocampus shows strong cytoplasmic and nucleolar positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/2402_RPIP8-Antibody-Immunohistochemistry-Paraffin-NBP1-80855-img0007.jpg)
Immunohistochemistry-Paraffin: RPIP8 Antibody [NBP1-80855] - Staining of human hippocampus shows strong cytoplasmic and nucleolar positivity in neuronal cells.