ZMYND19 Antibody
| Name | ZMYND19 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81047 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZMYND19 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZMYND19 |
| Supplier Page | Shop |
Product images
![Western Blot: ZMYND19 Antibody [NBP1-81047] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17645_ZMYND19%2520Antibody-Western%2520Blot-NBP1-81047-img0005.jpg)
Western Blot: ZMYND19 Antibody [NBP1-81047] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: ZMYND19 Antibody [NBP1-81047] - Staining of human cell line A-431 shows positivity in golgi apparatus & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17646_ZMYND19-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81047-img0004.jpg)
Immunocytochemistry/Immunofluorescence: ZMYND19 Antibody [NBP1-81047] - Staining of human cell line A-431 shows positivity in golgi apparatus & vesicles.
![Immunohistochemistry-Paraffin: ZMYND19 Antibody [NBP1-81047] - Staining of human pancreas shows strong positivity in exocrine cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17647_ZMYND19-Antibody-Immunohistochemistry-Paraffin-NBP1-81047-img0002.jpg)
Immunohistochemistry-Paraffin: ZMYND19 Antibody [NBP1-81047] - Staining of human pancreas shows strong positivity in exocrine cells.