MRPS35 Antibody
| Name | MRPS35 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82786 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MRPS35 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MRPS28 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MRPS35 Antibody [NBP1-82786] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17277_MRPS35-Antibody-Western-Blot-NBP1-82786-img0005.jpg)
Western Blot: MRPS35 Antibody [NBP1-82786] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: MRPS35 Antibody [NBP1-82786] - Staining of human cell line A-431 shows localization to cytosol & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17278_MRPS35-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82786-img0006.jpg)
Immunocytochemistry/Immunofluorescence: MRPS35 Antibody [NBP1-82786] - Staining of human cell line A-431 shows localization to cytosol & mitochondria.
![Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17279_MRPS35-Antibody-Immunohistochemistry-Paraffin-NBP1-82786-img0002.jpg)
Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.