G3BP2 Antibody
| Name | G3BP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82976 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | G3BP2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | G3BP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: G3BP2 Antibody [NBP1-82976] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3198_G3BP2-Antibody-Western-Blot-NBP1-82976-img0009.jpg)
Western Blot: G3BP2 Antibody [NBP1-82976] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunocytochemistry/Immunofluorescence: G3BP2 Antibody [NBP1-82976] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3199_G3BP2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82976-img0011.jpg)
Immunocytochemistry/Immunofluorescence: G3BP2 Antibody [NBP1-82976] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
![Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3200_G3BP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82976-img0010.jpg)
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
![Western Blot: G3BP2 Antibody [NBP1-82976] - Analysis in human cell line SH-SY5Y.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3201_G3BP2-Antibody-Western-Blot-NBP1-82976-img0008.jpg)
Western Blot: G3BP2 Antibody [NBP1-82976] - Analysis in human cell line SH-SY5Y.
![Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3202_G3BP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82976-img0001.jpg)
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.