RNF44 Antibody
| Name | RNF44 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82930 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPSRPPHLPVEERRASAPAGGSPRMLHPATQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RNF44 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RNF44 |
| Supplier Page | Shop |
Product images
![Western Blot: RNF44 Antibody [NBP1-82930] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17996_RNF44%2520Antibody-Western%2520Blot-NBP1-82930-img0005.jpg)
Western Blot: RNF44 Antibody [NBP1-82930] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: RNF44 Antibody [NBP1-82930] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17997_RNF44-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82930-img0004.jpg)
Immunocytochemistry/Immunofluorescence: RNF44 Antibody [NBP1-82930] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: RNF44 Antibody [NBP1-82930] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17998_RNF44-Antibody-Immunohistochemistry-Paraffin-NBP1-82930-img0002.jpg)
Immunohistochemistry-Paraffin: RNF44 Antibody [NBP1-82930] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.