TRAM2 Antibody
| Name | TRAM2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83052 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:REYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSPRTKKLKSP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TRAM2 Protein |
| Description | Rabbit Polyclonal |
| Gene | TRAM2 |
| Supplier Page | Shop |
Product images
![Western Blot: TRAM2 Antibody [NBP1-83052] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18058_TRAM2-Antibody-Western-Blot-NBP1-83052-img0006.jpg)
Western Blot: TRAM2 Antibody [NBP1-83052] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: TRAM2 Antibody [NBP1-83052] - Staining of human cell line A-431 shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18059_TRAM2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83052-img0004.jpg)
Immunocytochemistry/Immunofluorescence: TRAM2 Antibody [NBP1-83052] - Staining of human cell line A-431 shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: TRAM2 Antibody [NBP1-83052] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18060_TRAM2-Antibody-Immunohistochemistry-Paraffin-NBP1-83052-img0002.jpg)
Immunohistochemistry-Paraffin: TRAM2 Antibody [NBP1-83052] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.