WDR73 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-82219
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:ISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDW
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: WDR73 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: WDR73

Product images

Western Blot: WDR73 Antibody [NBP1-82219] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409890)

Immunocytochemistry/Immunofluorescence: WDR73 Antibody [NBP1-82219] - Staining of human cell line A-431 shows positivity in vesicles.

Immunohistochemistry-Paraffin: WDR73 Antibody [NBP1-82219] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product References

Recessive nephrocerebellar syndrome on the Galloway-Mowat syndrome spectrum is - Recessive nephrocerebellar syndrome on the Galloway-Mowat syndrome spectrum is

Jinks RN, Puffenberger EG, Baple E, Harding B, Crino P, Fogo AB, Wenger O, Xin B, Koehler AE, McGlincy MH, Provencher MM, Smith JD, Tran L, Al Turki S, Chioza BA, Cross H, Harlalka GV, Hurles ME, Maroofian R, Heaps AD, Morton MC, Stempak L, Hildebrandt F, Sadowski CE, Zaritsky J, Campellone K, Morton DH, Wang H, Crosby A, Strauss KA. Brain. 2015 Aug;138(Pt 8):2173-90.