FAM136A Antibody

Name FAM136A Antibody
Supplier Novus Biologicals
Catalog NBP1-82226
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVT
Purity/Format Immunogen affinity purified
Blocking Peptide FAM136A Protein
Description Rabbit Polyclonal
Gene FAM136A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.