GAL3ST4 Antibody
| Name | GAL3ST4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82309 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTAEDRQLTARARAWNNLDWALYVHFNRSLWARIEKYGQGRLQTAVAE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GAL3ST4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GAL3ST4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GAL3ST4 Antibody [NBP1-82309] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16197_GAL3ST4%2520Antibody-Western%2520Blot-NBP1-82309-img0005.jpg)
Western Blot: GAL3ST4 Antibody [NBP1-82309] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: GAL3ST4 Antibody [NBP1-82309] - Staining of human cell line U-2 OS shows positivity in nucleus and mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16198_GAL3ST4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82309-img0004.jpg)
Immunocytochemistry/Immunofluorescence: GAL3ST4 Antibody [NBP1-82309] - Staining of human cell line U-2 OS shows positivity in nucleus and mitochondria.
![Immunohistochemistry-Paraffin: GAL3ST4 Antibody [NBP1-82309] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in seminiferus tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16199_GAL3ST4-Antibody-Immunohistochemistry-Paraffin-NBP1-82309-img0002.jpg)
Immunohistochemistry-Paraffin: GAL3ST4 Antibody [NBP1-82309] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in seminiferus tubules.