ACAD9 Antibody
| Name | ACAD9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82749 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:EILRMYIALTGLQHAGRILTTRIHELKQAKVSTVMDTVGRRLRDSLGRTVDLGLTGNHGVVHPSLADSANKFEENTYCFGRTVETLL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ACAD9 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ACAD9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ACAD9 Antibody [NBP1-82749] - Analysis in human cell line MCF-7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14881_ACAD9-Antibody-Western-Blot-NBP1-82749-img0006.jpg)
Western Blot: ACAD9 Antibody [NBP1-82749] - Analysis in human cell line MCF-7.
![Immunocytochemistry/Immunofluorescence: ACAD9 Antibody [NBP1-82749] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14882_ACAD9%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82749-img0007.jpg)
Immunocytochemistry/Immunofluorescence: ACAD9 Antibody [NBP1-82749] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
![Immunohistochemistry-Paraffin: ACAD9 Antibody [NBP1-82749] - Staining of human kidney shows strong granular cytoplasmic positivity in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14883_ACAD9-Antibody-Immunohistochemistry-Paraffin-NBP1-82749-img0001.jpg)
Immunohistochemistry-Paraffin: ACAD9 Antibody [NBP1-82749] - Staining of human kidney shows strong granular cytoplasmic positivity in tubules.