EPS8L2 Antibody
| Name | EPS8L2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83613 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EPS8L2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | EPS8L2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EPS8L2 Antibody [NBP1-83613] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26053_EPS8L2-Antibody-Western-Blot-NBP1-83613-img0007.jpg)
Western Blot: EPS8L2 Antibody [NBP1-83613] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
![Immunocytochemistry/Immunofluorescence: EPS8L2 Antibody [NBP1-83613] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26054_EPS8L2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83613-img0009.jpg)
Immunocytochemistry/Immunofluorescence: EPS8L2 Antibody [NBP1-83613] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: EPS8L2 Antibody [NBP1-83613] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26055_EPS8L2-Antibody-Immunohistochemistry-Paraffin-NBP1-83613-img0008.jpg)
Immunohistochemistry-Paraffin: EPS8L2 Antibody [NBP1-83613] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
![Western Blot: EPS8L2 Antibody [NBP1-83613] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26056_EPS8L2-Antibody-Western-Blot-NBP1-83613-img0005.jpg)
Western Blot: EPS8L2 Antibody [NBP1-83613] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4