Kif4A Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-83721
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:LTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKL
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: Kif4A Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: KIF4A
• Conjugate: Unconjugated

Product images

Western Blot: Kif4A Antibody [NBP1-83721] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: Kif4A Antibody [NBP1-83721] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: Kif4A Antibody [NBP1-83721] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.