NECAB1 Antibody
| Name | NECAB1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84005 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NECAB1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NECAB1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NECAB1 Antibody [NBP1-84005] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26025_NECAB1-Antibody-Western-Blot-NBP1-84005-img0007.jpg)
Western Blot: NECAB1 Antibody [NBP1-84005] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
![Immunocytochemistry/Immunofluorescence: NECAB1 Antibody [NBP1-84005] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26026_NECAB1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84005-img0008.jpg)
Immunocytochemistry/Immunofluorescence: NECAB1 Antibody [NBP1-84005] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
![Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26027_NECAB1-Antibody-Immunohistochemistry-Paraffin-NBP1-84005-img0002.jpg)
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
![Western Blot: NECAB1 Antibody [NBP1-84005] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411679)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26028_NECAB1-Antibody-Western-Blot-NBP1-84005-img0005.jpg)
Western Blot: NECAB1 Antibody [NBP1-84005] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411679)
![Western Blot: NECAB1 Antibody [NBP1-84005] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26029_NECAB1-Antibody-Western-Blot-NBP1-84005-img0006.jpg)
Western Blot: NECAB1 Antibody [NBP1-84005] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue