Homez Antibody
| Name | Homez Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81405 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PDIQPLERYWAAHQQLRETDIPQLSQASRLSTQQVLDWFDSRLPQPAEVVVCLDE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Homez Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HOMEZ |
| Supplier Page | Shop |
Product images
![Western Blot: Homez Antibody [NBP1-81405] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18743_Homez%2520Antibody-Western%2520Blot-NBP1-81405-img0005.jpg)
Western Blot: Homez Antibody [NBP1-81405] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: Homez Antibody [NBP1-81405] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18744_Homez-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81405-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Homez Antibody [NBP1-81405] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: Homez Antibody [NBP1-81405] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18745_Homez-Antibody-Immunohistochemistry-Paraffin-NBP1-81405-img0002.jpg)
Immunohistochemistry-Paraffin: Homez Antibody [NBP1-81405] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts.