EFR3A Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-81539
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human, Mouse, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLMVTSGYKAKTIVTALPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPDVADLKIKREKICRQDTSFMK
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: EFR3A Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: EFR3A

Product images

Western Blot: EFR3A Antibody [NBP1-81539] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).

Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human kidney shows cytoplasmic positivity in tubular cells.

Western Blot: EFR3A Antibody [NBP1-81539] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue