UHRF1BP1L Antibody
| Name | UHRF1BP1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81486 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:CNHWMYFSDATKTKNGWANELLHEFECNVEMLKQAVKDHNVGSPPKSPTHASPQHTQTEKDYPLKGTCRTPSVLSQQSKAKLMSSSV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UHRF1BP1L Protein |
| Description | Rabbit Polyclonal |
| Gene | UHRF1BP1L |
| Supplier Page | Shop |
Product images
![Western Blot: UHRF1BP1L Antibody [NBP1-81486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18847_UHRF1BP1L%2520Antibody-Western%2520Blot-NBP1-81486-img0005.jpg)
Western Blot: UHRF1BP1L Antibody [NBP1-81486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: UHRF1BP1L Antibody [NBP1-81486] - Staining of human cell line U-2 OS shows positivity in plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18848_UHRF1BP1L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81486-img0004.jpg)
Immunocytochemistry/Immunofluorescence: UHRF1BP1L Antibody [NBP1-81486] - Staining of human cell line U-2 OS shows positivity in plasma membrane.
![Immunohistochemistry-Paraffin: UHRF1BP1L Antibody [NBP1-81486] - Staining of human prostate shows strong cytoplasmic and membrane positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/18849_UHRF1BP1L-Antibody-Immunohistochemistry-Paraffin-NBP1-81486-img0002.jpg)
Immunohistochemistry-Paraffin: UHRF1BP1L Antibody [NBP1-81486] - Staining of human prostate shows strong cytoplasmic and membrane positivity in glandular cells.