SLC22A9 Antibody
| Name | SLC22A9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82068 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RVGNTQIPGHGNYIGNVPFWYCIYDPGRPGFCHSRLAYPPAGGVCTILCDLSDLK |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC22A9 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC22A9 Antibody [NBP1-82068] - Staining of human cell line A-431 shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19221_SLC22A9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82068-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC22A9 Antibody [NBP1-82068] - Staining of human cell line A-431 shows positivity in mitochondria.
![Immunohistochemistry-Paraffin: SLC22A9 Antibody [NBP1-82068] - Staining of human pancreas shows distinct positivity in exocrine cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19222_SLC22A9-Antibody-Immunohistochemistry-Paraffin-NBP1-82068-img0002.jpg)
Immunohistochemistry-Paraffin: SLC22A9 Antibody [NBP1-82068] - Staining of human pancreas shows distinct positivity in exocrine cells.
![Western Blot: SLC22A9 Antibody [NBP1-82068] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/29901_SLC22A9-Antibody-Western-Blot-NBP1-82068-img0006.jpg)
Western Blot: SLC22A9 Antibody [NBP1-82068] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp