SPATA20 Antibody
| Name | SPATA20 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82147 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SHPSSTPQRVPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLSEDFVSVKV |
| Description | Rabbit Polyclonal |
| Gene | SPATA20 |
| Supplier Page | Shop |
Product images
![Western Blot: SPATA20 Antibody [NBP1-82147] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19285_SPATA20%2520Antibody-Western%2520Blot-NBP1-82147-img0005.jpg)
Western Blot: SPATA20 Antibody [NBP1-82147] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: SPATA20 Antibody [NBP1-82147] - Staining of human cell line U-2 OS shows positivity in nuclei but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19286_SPATA20-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82147-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SPATA20 Antibody [NBP1-82147] - Staining of human cell line U-2 OS shows positivity in nuclei but not nucleoli.
![Immunohistochemistry-Paraffin: SPATA20 Antibody [NBP1-82147] - Staining of human testis shows general distinct nuclear positivity which in some cells of the seminiferus ducts was combined with cytoplasmic staining.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19287_SPATA20-Antibody-Immunohistochemistry-Paraffin-NBP1-82147-img0003.jpg)
Immunohistochemistry-Paraffin: SPATA20 Antibody [NBP1-82147] - Staining of human testis shows general distinct nuclear positivity which in some cells of the seminiferus ducts was combined with cytoplasmic staining.