C2orf43 Antibody
| Name | C2orf43 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82135 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C2orf43 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LDAH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C2orf43 Antibody [NBP1-82135] - Analysis in human cell line SH-SY5Y.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16009_C2orf43-Antibody-Western-Blot-NBP1-82135-img0006.jpg)
Western Blot: C2orf43 Antibody [NBP1-82135] - Analysis in human cell line SH-SY5Y.
![Immunocytochemistry/Immunofluorescence: C2orf43 Antibody [NBP1-82135] - Staining of human cell line A-431 shows positivity in cytoplasm and nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16010_C2orf43-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82135-img0008.jpg)
Immunocytochemistry/Immunofluorescence: C2orf43 Antibody [NBP1-82135] - Staining of human cell line A-431 shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
![Immunohistochemistry-Paraffin: C2orf43 Antibody [NBP1-82135] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16011_C2orf43-Antibody-Immunohistochemistry-Paraffin-NBP1-82135-img0002.jpg)
Immunohistochemistry-Paraffin: C2orf43 Antibody [NBP1-82135] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.