FAM170A Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-32706
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: VSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRN
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: FAM170A Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: FAM170A
• Conjugate: Unconjugated

Product images

Western Blot: FAM170A Antibody [NBP2-32706] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: FAM170A Antibody [NBP2-32706] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Western Blot: FAM170A Antibody [NBP2-32706] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: FAM170A Antibody [NBP2-32706] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.