RNF25 Antibody
| Name | RNF25 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32664 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRWERSKGRTPGSSYPR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RNF25 Protein |
| Description | Rabbit Polyclonal |
| Gene | RNF25 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RNF25 Antibody [NBP2-32664] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-482](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15223_RNF25-Antibody-Western-Blot-NBP2-32664-img0004.jpg)
Western Blot: RNF25 Antibody [NBP2-32664] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-482
![Immunocytochemistry/Immunofluorescence: RNF25 Antibody [NBP2-32664] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15224_RNF25%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32664-img0005.jpg)
Immunocytochemistry/Immunofluorescence: RNF25 Antibody [NBP2-32664] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
![Immunohistochemistry: RNF25 Antibody [NBP2-32664] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15225_RNF25-Antibody-Immunohistochemistry-NBP2-32664-img0003.jpg)
Immunohistochemistry: RNF25 Antibody [NBP2-32664] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.