ZNF662 Antibody
| Name | ZNF662 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32632 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SQELWFGKTCEEKSRLGRWPGYLNGGRMESSTNDIIEVIVKDEMISVEESSGNTDVNNLLGIHHKILNEQI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF662 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZNF662 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF662 Antibody [NBP2-32632] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8201_ZNF662-Antibody-Western-Blot-NBP2-32632-img0004.jpg)
Western Blot: ZNF662 Antibody [NBP2-32632] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunohistochemistry-Paraffin: ZNF662 Antibody [NBP2-32632] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8202_ZNF662-Antibody-Immunohistochemistry-Paraffin-NBP2-32632-img0005.jpg)
Immunohistochemistry-Paraffin: ZNF662 Antibody [NBP2-32632] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.