NAF1 Antibody
| Name | NAF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32658 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SSCISLPPVLSDGDDDLQVEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NAF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NAF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: NAF1 Antibody [NBP2-32658] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-372](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25432_NAF1-Antibody-Western-Blot-NBP2-32658-img0002.jpg)
![Immunohistochemistry-Paraffin: NAF1 Antibody [NBP2-32658] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25433_NAF1-Antibody-Immunohistochemistry-Paraffin-NBP2-32658-img0005.jpg)