IFIT3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-32500
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: IFIT3 Protein
• Description: Rabbit Polyclonal
• Gene: IFIT3

Product images

Western Blot: IFIT3 Antibody [NBP2-32500] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Immunohistochemistry: IFIT3 Antibody [NBP2-32500] - liver cancer

Immunohistochemistry: IFIT3 Antibody [NBP2-32500] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry: IFIT3 Antibody [NBP2-32500] - liver