SYCE1L Antibody
| Name | SYCE1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32361 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: APEATEEAEGQAKSLKTEDLLAMVIKLQKE |
| Description | Rabbit Polyclonal |
| Gene | SYCE1L |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SYCE1L Antibody [NBP2-32361] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19568_SYCE1L-Antibody-Immunohistochemistry-NBP2-32361-img0005.jpg)
Immunohistochemistry: SYCE1L Antibody [NBP2-32361] - liver
![Immunohistochemistry: SYCE1L Antibody [NBP2-32361] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19569_SYCE1L-Antibody-Immunohistochemistry-NBP2-32361-img0001.jpg)
Immunohistochemistry: SYCE1L Antibody [NBP2-32361] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.
![Immunohistochemistry: SYCE1L Antibody [NBP2-32361] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19570_SYCE1L-Antibody-Immunohistochemistry-NBP2-32361-img0002.jpg)
Immunohistochemistry: SYCE1L Antibody [NBP2-32361] - liver
![Immunohistochemistry: SYCE1L Antibody [NBP2-32361] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19571_SYCE1L-Antibody-Immunohistochemistry-NBP2-32361-img0003.jpg)
Immunohistochemistry: SYCE1L Antibody [NBP2-32361] - liver cancer
![Immunohistochemistry: SYCE1L Antibody [NBP2-32361] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19572_SYCE1L-Antibody-Immunohistochemistry-NBP2-32361-img0004.jpg)
Immunohistochemistry: SYCE1L Antibody [NBP2-32361] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.