SLC35C2 Antibody
| Name | SLC35C2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32008 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC35C2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC35C2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: SLC35C2 Antibody [NBP2-32008] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8436_SLC35C2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32008-img0007.jpg)
![Immunohistochemistry: SLC35C2 Antibody [NBP2-32008] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8437_SLC35C2-Antibody-Immunohistochemistry-NBP2-32008-img0004.jpg)