PMCA4 Antibody
| Name | PMCA4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31984 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: THPEFAIEEELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PMCA4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ATP2B4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PMCA4 Antibody [NBP2-31984] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25580_PMCA4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31984-img0005.jpg)
Immunocytochemistry/Immunofluorescence: PMCA4 Antibody [NBP2-31984] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
![Immunohistochemistry: PMCA4 Antibody [NBP2-31984] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25581_PMCA4-Antibody-Immunohistochemistry-NBP2-31984-img0002.jpg)
Immunohistochemistry: PMCA4 Antibody [NBP2-31984] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.
![Immunocytochemistry/Immunofluorescence: PMCA4 Antibody [NBP2-31984] - Staining of human cell line A-431 shows positivity in plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25582_PMCA4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31984-img0001.jpg)
Immunocytochemistry/Immunofluorescence: PMCA4 Antibody [NBP2-31984] - Staining of human cell line A-431 shows positivity in plasma membrane.