TAFA5/FAM19A5 Antibody
| Name | TAFA5/FAM19A5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31879 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLIN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TAFA5/FAM19A5 Protein |
| Description | Rabbit Polyclonal |
| Gene | FAM19A5 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: FAM19A5 Antibody [NBP2-31879] - skin](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19678_FAM19A5-Antibody-Immunohistochemistry-NBP2-31879-img0005.jpg)
Immunohistochemistry: FAM19A5 Antibody [NBP2-31879] - skin
![Immunohistochemistry: FAM19A5 Antibody [NBP2-31879] - Immunohistochemical staining of human urinary bladder shows strong cytpolasmic and membranous positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19679_FAM19A5-Antibody-Immunohistochemistry-NBP2-31879-img0001.jpg)
Immunohistochemistry: FAM19A5 Antibody [NBP2-31879] - Immunohistochemical staining of human urinary bladder shows strong cytpolasmic and membranous positivity in urothelial cells.
![Immunohistochemistry: FAM19A5 Antibody [NBP2-31879] - Immunohistochemical staining of human urinary bladder shows strong cytpolasmic and membranous positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19680_FAM19A5-Antibody-Immunohistochemistry-NBP2-31879-img0003.jpg)
Immunohistochemistry: FAM19A5 Antibody [NBP2-31879] - Immunohistochemical staining of human urinary bladder shows strong cytpolasmic and membranous positivity in urothelial cells.
![Immunohistochemistry: FAM19A5 Antibody [NBP2-31879] - Immunohistochemical staining of human urinary bladder shows strong cytpolasmic and membranous positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19681_FAM19A5-Antibody-Immunohistochemistry-NBP2-31879-img0004.jpg)
Immunohistochemistry: FAM19A5 Antibody [NBP2-31879] - Immunohistochemical staining of human urinary bladder shows strong cytpolasmic and membranous positivity in urothelial cells.
![Immunohistochemistry: FAM19A5 Antibody [NBP2-31879] - pancreatic cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19682_FAM19A5%2520Antibody-Immunohistochemistry-NBP2-31879-img0006.jpg)
Immunohistochemistry: FAM19A5 Antibody [NBP2-31879] - pancreatic cancer