Claudin-12 Antibody
| Name | Claudin-12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87450 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Claudin-12 Protein |
| Description | Rabbit Polyclonal |
| Gene | CLDN12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Claudin-12 Antibody [NBP1-87450] - Analysis in human liver tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21096_Claudin-12%2520Antibody-Western%2520Blot-NBP1-87450-img0007.jpg)
Western Blot: Claudin-12 Antibody [NBP1-87450] - Analysis in human liver tissue.
![Immunohistochemistry-Paraffin: Claudin-12 Antibody [NBP1-87450] - Staining of human pancreas shows moderate cytoplasmic and membranous positivity in exocrine glandular cells along with moderate cytoplasmic staining in islets of Langerhans](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21097_Claudin-12-Antibody-Immunohistochemistry-Paraffin-NBP1-87450-img0006.jpg)
Immunohistochemistry-Paraffin: Claudin-12 Antibody [NBP1-87450] - Staining of human pancreas shows moderate cytoplasmic and membranous positivity in exocrine glandular cells along with moderate cytoplasmic staining in islets of Langerhans