Transketolase Antibody
| Name | Transketolase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87442 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:HYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Transketolase Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TKT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Transketolase Antibody [NBP1-87442] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22115_Transketolase-Antibody-Western-Blot-NBP1-87442-img0009.jpg)
Western Blot: Transketolase Antibody [NBP1-87442] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunocytochemistry/Immunofluorescence: Transketolase Antibody [NBP1-87442] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22116_Transketolase%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87442-img0011.jpg)
Immunocytochemistry/Immunofluorescence: Transketolase Antibody [NBP1-87442] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22117_Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87442-img0010.jpg)
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
![Western Blot: Transketolase Antibody [NBP1-87442] - Analysis in human cell line A-549.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22118_Transketolase-Antibody-Western-Blot-NBP1-87442-img0008.jpg)
Western Blot: Transketolase Antibody [NBP1-87442] - Analysis in human cell line A-549.
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human kidney shows strong nuclear positivity in cells of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22119_Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87442-img0002.jpg)
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human kidney shows strong nuclear positivity in cells of tubules.