SHCBP1L Antibody
| Name | SHCBP1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90716 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FPGEYQAANLALLTDDIIIKGVGKREEIMITSEPSRDSFVVSKADNVKLMHLSLIQQGTVDGIVVVESGHMTLENCILKCEGTGVC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SHCBP1L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SHCBP1L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SHCBP1L Antibody [NBP1-90716] - Staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm and cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17094_SHCBP1L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90716-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SHCBP1L Antibody [NBP1-90716] - Staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm and cell junctions.
![Immunohistochemistry: SHCBP1L Antibody [NBP1-90716] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17095_SHCBP1L-Antibody-Immunohistochemistry-NBP1-90716-img0006.jpg)
Immunohistochemistry: SHCBP1L Antibody [NBP1-90716] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
![Immunohistochemistry-Paraffin: SHCBP1L Antibody [NBP1-90716] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17096_SHCBP1L-Antibody-Immunohistochemistry-Paraffin-NBP1-90716-img0002.jpg)
Immunohistochemistry-Paraffin: SHCBP1L Antibody [NBP1-90716] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.