Eaf6 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-90715
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:RRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEP
• Description: Rabbit Polyclonal
• Gene: MEAF6

Product images

Immunocytochemistry/Immunofluorescence: Eaf6 Antibody [NBP1-90715] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.

Immunohistochemistry: Eaf6 Antibody [NBP1-90715] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411575)

Immunohistochemistry-Paraffin: Eaf6 Antibody [NBP1-90715] - Staining of human smooth muscle shows strong positivity in muscle cells.