Eaf6 Antibody

Name	Eaf6 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-90714
Host	Rabbit
Clonality	Polyclonal
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:SQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHSPSGMFDYDFEIDLKLNK
Description	Rabbit Polyclonal
Gene	MEAF6
Supplier Page	Shop

Product images

Western Blot: Eaf6 Antibody [NBP1-90714] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411575)

Western Blot: Eaf6 Antibody [NBP1-90714] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411575)

Immunocytochemistry/Immunofluorescence: Eaf6 Antibody [NBP1-90714] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli, cytoplasm & centrosome.

Immunohistochemistry-Paraffin: Eaf6 Antibody [NBP1-90714] - staining of human heart muscle shows strong cytoplasmic positivity in myocytes.