Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody
| Name | Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90913 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RKRQEQRKFLKGRLLQTHFQSQGQGQSQNPNQNQSQNPNPNANQNLTQNLMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTND |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HS6ST2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody [NBP1-90913] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24749_Heparan%2520Sulfate%25206-O-Sulfotransferase%25202-HS6ST2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90913-img0005.jpg)
Immunocytochemistry/Immunofluorescence: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody [NBP1-90913] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody [NBP1-90913] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24750_Heparan-Sulfate-6-O-Sulfotransferase-2-HS6ST2-Antibody-Immunohistochemistry-Paraffin-NBP1-90913-img0002.jpg)
Immunohistochemistry-Paraffin: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody [NBP1-90913] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.