C3orf33 Antibody
| Name | C3orf33 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90874 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RLTSKFTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C3orf33 Protein |
| Description | Rabbit Polyclonal |
| Gene | C3orf33 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C3orf33 Antibody [NBP1-90874] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10988_C3orf33%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90874-img0006.jpg)
Immunocytochemistry/Immunofluorescence: C3orf33 Antibody [NBP1-90874] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: C3orf33 Antibody [NBP1-90874] - Staining of human vulva/anal skin shows strong nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10989_C3orf33-Antibody-Immunohistochemistry-Paraffin-NBP1-90874-img0002.jpg)
Immunohistochemistry-Paraffin: C3orf33 Antibody [NBP1-90874] - Staining of human vulva/anal skin shows strong nuclear positivity in squamous epithelial cells.