TMPRSS7 Antibody
| Name | TMPRSS7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90893 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DESDELFCVSPQPACNTSSFRQHGPLICDGFRDCENGRDEQNCTQSIPCNNRTFKCGNDICFRKQNAKCD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TMPRSS7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TMPRSS7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TMPRSS7 Antibody [NBP1-90893] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/706_TMPRSS7%2520Antibody-Immunohistochemistry-Paraffin-NBP1-90893-img0008.jpg)
Immunohistochemistry-Paraffin: TMPRSS7 Antibody [NBP1-90893] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.