SLC9B1 Antibody
| Name | SLC9B1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90664 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQTKKETYISCPLRGVLN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC9B1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC9B1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC9B1 Antibody [NBP1-90664] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14024_SLC9B1-Antibody-Western-Blot-NBP1-90664-img0006.jpg)
Western Blot: SLC9B1 Antibody [NBP1-90664] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: SLC9B1 Antibody [NBP1-90664] - Staining of human cell line A-431 shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14025_SLC9B1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90664-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC9B1 Antibody [NBP1-90664] - Staining of human cell line A-431 shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: SLC9B1 Antibody [NBP1-90664] - Staining of human nasopharynx shows cytoplasmic and nuclear positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14026_SLC9B1-Antibody-Immunohistochemistry-Paraffin-NBP1-90664-img0002.jpg)
Immunohistochemistry-Paraffin: SLC9B1 Antibody [NBP1-90664] - Staining of human nasopharynx shows cytoplasmic and nuclear positivity in respiratory epithelial cells.