C21orf56 Antibody
| Name | C21orf56 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90940 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GSVDERKLRELTQRYLALSARLEKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDVVPPKFLGDSLLLLNCLCELSKEDGKPLF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C21orf56 Protein |
| Description | Rabbit Polyclonal |
| Gene | SPATC1L |
| Supplier Page | Shop |
Product images
![Western Blot: C21orf56 Antibody [NBP1-90940] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410249)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/20340_C21orf56%2520Antibody-Western%2520Blot-NBP1-90940-img0004.jpg)
Western Blot: C21orf56 Antibody [NBP1-90940] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410249)
![Immunohistochemistry-Paraffin: C21orf56 Antibody [NBP1-90940] - Staining of human testis shows strong nuclear positivity in seminiferus duct cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/20341_C21orf56-Antibody-Immunohistochemistry-Paraffin-NBP1-90940-img0002.jpg)
Immunohistochemistry-Paraffin: C21orf56 Antibody [NBP1-90940] - Staining of human testis shows strong nuclear positivity in seminiferus duct cells.
Product References
The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. - The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas.
Bolander A, Agnarsdottir M, Stromberg S, Ponten F, Hesselius P, Uhlen M, Bergqvist M. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):293-300.
Antibody-based protein profiling of the human chromosome 21. - Antibody-based protein profiling of the human chromosome 21.
Uhlen M, Oksvold P, Algenas C, Hamsten C, Fagerberg L, Klevebring D, Lundberg E, Odeberg J, Ponten F, Kondo T, Sivertsson A. Mol Cell Proteomics. 2012 Mar;11(3):M111.013458.