C22orf43 Antibody
| Name | C22orf43 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90938 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ILPSRVQGGCYRFDSSSCSSEDNLSLVCLPRSEDDDCDDDDDDAQILPSRVQACSEDSLFLRCSLRHKDEEEEDDDD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C22orf43 Protein |
| Description | Rabbit Polyclonal |
| Gene | DRICH1 |
| Supplier Page | Shop |
Product images
![Western Blot: C22orf43 Antibody [NBP1-90938] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/20342_C22orf43%2520Antibody-Western%2520Blot-NBP1-90938-img0005.jpg)
Western Blot: C22orf43 Antibody [NBP1-90938] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: C22orf43 Antibody [NBP1-90938] - Staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/20343_C22orf43-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90938-img0004.jpg)
Immunocytochemistry/Immunofluorescence: C22orf43 Antibody [NBP1-90938] - Staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
![Immunohistochemistry-Paraffin: C22orf43 Antibody [NBP1-90938] - Staining of human adrenal gland shows strong nuclear positivity in cortical cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/20344_C22orf43-Antibody-Immunohistochemistry-Paraffin-NBP1-90938-img0002.jpg)
Immunohistochemistry-Paraffin: C22orf43 Antibody [NBP1-90938] - Staining of human adrenal gland shows strong nuclear positivity in cortical cells.