KIAA1045 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-90937
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALSEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLR
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: KIAA1045 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: KIAA1045
• Conjugate: Unconjugated

Product images

Western Blot: KIAA1045 Antibody [NBP1-90937] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: KIAA1045 Antibody [NBP1-90937] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and vesicles.

Immunohistochemistry-Paraffin: KIAA1045 Antibody [NBP1-90937] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.