Ankyrin repeat domain 39 Antibody

Name Ankyrin repeat domain 39 Antibody
Supplier Novus Biologicals
Catalog NBP1-91673
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:RVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTE
Purity/Format Immunogen affinity purified
Blocking Peptide Ankyrin repeat domain 39 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ANKRD39
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.