TSC21 Antibody

Name TSC21 Antibody
Supplier Novus Biologicals
Catalog NBP1-91727
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:PVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLP
Purity/Format Immunogen affinity purified
Blocking Peptide TSC21 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene TEX37
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.